PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn032521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family LBD
Protein Properties Length: 176aa    MW: 19487.4 Da    PI: 7.3842
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn032521genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.13.4e-39231167100
      DUF260   7 vlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 +lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lp  +r da++s+vyeA+ar+rdP+yG+vg i++lq+q++ l+++lal+++e
  Achn032521  23 LLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPLYQRGDAVKSIVYEANARIRDPIYGCVGAISSLQHQIDVLQTQLALAQAE 116
                 589**************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.97916117IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-3923114IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MLLKIITTSK SFDLNLVRDL ALLLRRRCAQ DCVFAPYFPA DEPQKFASVH KVFGASNVNK  60
MLQELPLYQR GDAVKSIVYE ANARIRDPIY GCVGAISSLQ HQIDVLQTQL ALAQAEVVHM  120
QMRQVSSSMS SNPATNSLEN GSDKAIPISQ TNKSLFNMDI MMVDQPNMGD SFWSC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882228.12e-80PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE95e-62LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A0J8DXN73e-77A0A0J8DXN7_BETVU; Uncharacterized protein
STRINGSolyc11g045530.1.17e-76(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.15e-52LOB domain-containing protein 4